Protein or peptide name:	ROTUNDIFOLIA4
Chromosome:	2
Protein or peptide start site:	15534942
Protein or peptide end site:	15535104
ncRNA start site:	15534739
ncRNA end site:	15535304
Genome Browser:	NA
Protein or peptide sequence:	MAPEENGTCEPCKTFGQKCSHVVKKQRAKFYILRRCIAMLVCWHDQNHDRKDS
Protein or peptide length:	53aa
ncRNA type:	ncRNA
ncRNA name:	ROT4
Entrez ID:	2745585
Experimental species:	Arabidopsis thaliana
Experimental techniques:	RT-PCR/ in situ hybridization
Experimental sample (cell line and/or tissue):	Arabidopsis thaliana
Description:	The ROT4 open-reading frame (ORF) encodes a novel small peptide that had not been identified in the Arabidopsis genome annotation.
Subcellular location:	plasma membrane
Function:	Overexpression of a ROT4-green fluorescence protein (GFP) fusion protein in transgenic plants recapitulated the rot4 phenotype, suggesting that ROT4 acts to restrict cell proliferation.
Title of paper:	Overexpression of a novel small peptide ROTUNDIFOLIA4 decreases cell proliferation and alters leaf shape in Arabidopsis thaliana
PMID:	15125775
Year of publication:	2004